PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015865865.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 439aa    MW: 48218.5 Da    PI: 4.6268
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015865865.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS231.53.9e-7124743872274
            GRAS  72 knsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLa 166
                     ++s e+l+++++ ++++P++kf+h+taNqaI ea+e e+rvH+iD+di qG QWpa++qaLa+Rp+g+p lRiTgvg+    s ++++etg+ L+
  XP_015865865.1 247 SSSLEVLKIYQIVYQACPYVKFAHFTANQAIFEAFEAEDRVHVIDLDILQGYQWPAFMQALAARPSGAPFLRITGVGP----SIDTVRETGRCLT 337
                     3489999***********************************************************************....9************ PP

            GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                     ++A++l+vpfef++ v ++ledl+++++  + gEalaVn+v +lhr++    +l     ++L ++++  P++v++veqea+hn++ Fl rfleal
  XP_015865865.1 338 ELAHSLHVPFEFHA-VGEELEDLKPHMFYRRVGEALAVNSVNRLHRVP--GNCLG----NLLTMIRDQAPNIVTLVEQEASHNGPYFLGRFLEAL 425
                     **************.7************9999***************9..44444....5*********************************** PP

            GRAS 262 eyysalfdsleak 274
                     +y+ a+fdsl+a+
  XP_015865865.1 426 HYFPAIFDSLDAT 438
                     **********876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.075157439IPR005202Transcription factor GRAS
PfamPF035141.3E-68247438IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MDQQQSSLTP PSLNFPTLKF DLDGDLEVQS PDNSSLWESL FSDQFDSDFM ILSPVRNLPS  60
PRQTSNYNYN NNYNYAQSMQ GQSLLGCSPP RFGSQVGAAF SSRGKGLSPL HRVFNSPNNN  120
NGSSSNQYMQ HTDTFALQAI EDFLDDYQRD GFVVGGFNKM TGMAGGGGNS SSEQSYDIPT  180
PPTLDCLAIP NSSSSSRFCG SASETSSGPG GSQVTQEGGG YQMGTIGPGA PLSEQLRQER  240
REDNFPSSSL EVLKIYQIVY QACPYVKFAH FTANQAIFEA FEAEDRVHVI DLDILQGYQW  300
PAFMQALAAR PSGAPFLRIT GVGPSIDTVR ETGRCLTELA HSLHVPFEFH AVGEELEDLK  360
PHMFYRRVGE ALAVNSVNRL HRVPGNCLGN LLTMIRDQAP NIVTLVEQEA SHNGPYFLGR  420
FLEALHYFPA IFDSLDATQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3224843672270GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015865865.10.0PREDICTED: DELLA protein GAIP-like
TrEMBLW9S6I41e-126W9S6I4_9R
STRINGGLYMA16G05751.11e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF94703243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-55RGA-like 1